SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000061935 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000061935
Domain Number 1 Region: 37-139
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-18
Family Thyroglobulin type-1 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000061935   Gene: ENSMUSG00000045394   Transcript: ENSMUST00000053577
Sequence length 315
Comment pep:known chromosome:GRCm38:17:87635979:87651106:1 gene:ENSMUSG00000045394 transcript:ENSMUST00000053577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQALAFGLLLAVVTATLAAAQRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICS
KLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKF
IKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEP
LDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVSLAVIAGIVVLVISTRKKSAKYEK
AEIKEMGEIHRELNA
Download sequence
Identical sequences Q99JW5
ENSMUSP00000061935 ENSMUSP00000061935 ENSMUSP00000061935 NP_032558.2.92730 10090.ENSMUSP00000061935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]