SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065020 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065020
Domain Number 1 Region: 296-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-36
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily RING/U-box 5.5e-26
Family RING finger domain, C3HC4 0.0055
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000065020
Domain Number - Region: 120-259
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00144
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065020   Gene: ENSMUSG00000057596   Transcript: ENSMUST00000071069
Sequence length 497
Comment pep:known chromosome:GRCm38:7:104470014:104507849:-1 gene:ENSMUSG00000057596 transcript:ENSMUST00000071069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVLEMIKEEVTCPICLELLKESVSADCNHSFCRACITLHYESNRNPEGEGNCPVCRV
PYLFENLRPNRHVANIVERLKGFKSIPEEEQKVNACVEHGEKLQLFCKEDMMAICWLCKQ
SQEHSGHQTALIEEVNHEYKEKLQAALQKLMENEKRCDEWQDDLQQQRADWENQIHSDIE
DIQIEFNGLRDLLDSKENEKLQELKKEKEEVMEKLEESEHELREQRELVRDLISYVQHQL
ELSVMEMKQGVNYVLTSIQTMTLKQPQIVPPKRRRGTSKAPHLKGMLQSFEGLMDVQQYW
VHMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRS
DAWLLGLNDGKCAQPQLHSKEEMGIKKKYHSHIKQNVTFQPKCGYWVIGMKNSSVYNAFD
ECSITHNSSVLALSLPDRPSRVGVFLDQEVCTLSFYDVSNSGALIYRFYDPSFPVEVYPY
FNPMECSEPMTVCGPPS
Download sequence
Identical sequences E9PWL0
NP_954597.2.92730 10090.ENSMUSP00000102434 ENSMUSP00000065020 ENSMUSP00000033211 ENSMUSP00000033211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]