SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067685 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067685
Domain Number 1 Region: 883-1010,1042-1247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-77
Family p120GAP domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 33-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.17e-36
Family Calponin-homology domain, CH-domain 0.0000234
Further Details:      
 
Domain Number 3 Region: 1477-1575
Classification Level Classification E-value
Superfamily RGC domain-like 2.22e-33
Family RGC domain 0.0000116
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000067685
Domain Number - Region: 542-748
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00069
Family Motor proteins 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067685   Gene: ENSMUSG00000021676   Transcript: ENSMUST00000068603
Sequence length 1575
Comment pep:known chromosome:GRCm38:13:95627177:95891922:-1 gene:ENSMUSG00000021676 transcript:ENSMUST00000068603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELP
PTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAM
EAIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIEKGVAKQTIITLRNP
NAVLTCVDDSLSQEYQKELWEAKKKKEESAKLKNSCISEEERDAYEELLTQAEIQSNIST
VNRMAAVDHINAVLQEGDPENTLLALKKPEAQLPAVYPFAAVMYQNELFNLQKQNTSNYL
AHEELLIAVEMLSAVALLNQALESSDLVAVQNQLRSPTIGFNNLDEAHVDRYADALLSVK
QEALSQGQDTLSWNEIQNCIDMINNQIQEENDRMVVLGYINEAIDAGNPLKTLDTLLLPT
ANIRDVDPDCAQHYQDVLFYTKSQKLGDPKNVSKVLWLDEIQQAINEANVDENRAKQWVT
LVVDVNECLDRKQSDHILTALKSSPSNIHNILPECANKYYDTLVKAKESKTDNESSEGSW
VTLNVQEKYNYYYNTDSKEGSWVPPELCLSKESWLTGEEIEDIVEEVTSDYIREKLWSAS
EDLLVRFEATTLGPALREEFEARKAFLYEQTESVVKIQAFWKGFKQRQEYLHRQQVFAGN
VDSVVKIQSWFRMVTARKSYLSRLRYFEDHKNEIVKIQSLLRASKARDDYKALVGSENPP
LTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHRKKLNKKKGGEIEILNNTDNKGIKSLSKERRKTLETYQQLFYLLQTKPSYLA
KLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTG
NPTVIKMVVSFNRGARGQNTLRQLLAPVVKEIIEDKALVINTNPVEVYKAWVNQLETQTG
EASKLPYDVTTEQALTYPEVKNKLEASIENLRKVTDKVLGSIISSLDLLPYGLRYIAKVL
KNSIREKFPDATEEELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSNQRRNLGS
VAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFQEACDVPEPEEKFNMDKYTDL
VTVSKPVIYISIEEIINTHLLLLEHQDAIATEKSDLLNELLESLGEVPTVESFLGEGAVD
PNDPNKENTLNQLSKTEISLSLTSKYDVKDGEAVDGRSLMIKTKKLIIDVTRNQPGSTLT
EILETPATGQQELEHAKDMESRAVVDSRTPEEGKQSQAVIEDARLPLEQKKRKIQRNLRT
LEQTGHVSSKNKYQDILNEIAKDIRNQRIHRKLRKAELSKLQQTLNALNKKAAFYEDQIN
YYDTYIKTCVDNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT
NQFKNVMFDIIATEDMGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVN
VNLLIYLLNKKFYGK
Download sequence
Identical sequences Q3UQ44
10090.ENSMUSP00000067685 NP_081987.1.92730 ENSMUSP00000067685 ENSMUSP00000067685 ENSMUSP00000067685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]