SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000068203 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000068203
Domain Number 1 Region: 144-242
Classification Level Classification E-value
Superfamily LCCL domain 3.79e-25
Family LCCL domain 0.00075
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000068203   Gene: ENSMUSG00000019891   Transcript: ENSMUST00000069004
Sequence length 503
Comment pep:known chromosome:GRCm38:10:52233619:52321376:1 gene:ENSMUSG00000019891 transcript:ENSMUST00000069004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGAGGPSVLALLFAVCAPLRLQAEELGDGCGHIVTSQDSGTMTSKNYPGTYPNYTVCE
KIITVPKGKRLILRLGDLNIESKTCASDYLLFSSATDQYGPYCGSWAVPKELRLNSNEVT
VLFKSGSHISGRGFLLTYASSDHPDLITCLERGSHYFEEKYSKFCPAGCRDIAGDISGNT
KDGYRDTSLLCKAAIHAGIITDELGGHINLLQSKGISHYEGLLANGVLSRHGSLSEKRFL
FTTPGMNITTVAIPSVIFIALLLTGMGIFAICRKRKKKGNPYVSADAQKTGCWKQIKYPF
ARHQSTEFTISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVARKGSTFRPMDTDTEEV
RVNTEASGHYDCPHRPGRHEYALPLTHSEPEYATPIVERHLLRAHTFSTQSGYRVPGPRP
THKHSHSSGGFPPATGATQVESYQRPASPKPVGGGYDKPAASSFLDSRDPASQSQMTSGG
DDGYSAPRNGLAPLNQTAMTALL
Download sequence
Identical sequences Q9D4J3
NP_079981.2.92730 ENSMUSP00000068203 ENSMUSP00000068203 10090.ENSMUSP00000068203 ENSMUSP00000068203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]