SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000068260 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000068260
Domain Number 1 Region: 42-237
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 2.62e-75
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000121
Further Details:      
 
Domain Number 2 Region: 318-474
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 8.76e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000068260   Gene: ENSMUSG00000028656   Transcript: ENSMUST00000069533
Sequence length 474
Comment pep:known chromosome:GRCm38:4:122859047:122885911:-1 gene:ENSMUSG00000028656 transcript:ENSMUST00000069533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKM
SKEIGGDVQKHAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREK
NRGSKFFNHLSAVSESIQALGWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVD
WVRAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPPP
ISTSSGSDDSASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFS
APKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTL
QIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLS
KNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences P40124
10090.ENSMUSP00000101864 ENSMUSP00000068260 ENSMUSP00000068260 ENSMUSP00000101862 ENSMUSP00000101864 NP_001287996.1.92730 NP_031624.2.92730 XP_006502758.1.92730 XP_006502760.1.92730 ENSMUSP00000068260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]