SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076435 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076435
Domain Number 1 Region: 354-520
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-42
Family Dual specificity phosphatase-like 0.0000105
Further Details:      
 
Domain Number 2 Region: 530-663
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.48e-38
Family PLC-like (P variant) 0.003
Further Details:      
 
Domain Number 3 Region: 212-344
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000534
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076435   Gene: ENSMUSG00000031481   Transcript: ENSMUST00000077194
Sequence length 664
Comment pep:known chromosome:GRCm38:8:22283441:22371418:1 gene:ENSMUSG00000031481 transcript:ENSMUST00000077194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGEKKSHLYLWMEHYGYDMPANIYKMYSQPSRKTDDANKKVSVSASRTIKLNGSTGYDT
NEQITLITNGSSLSYPDEIKSASYADPISTKAYTNDSSVYDPGGASSSTTLYELNSLSEV
SKEIITQGESALLRDKEATSELKIPSTLQTQTSMSTNTLSLSDLSSDYQEEQMNKCKLNQ
MSKLYDDDERTDIQKSYWNVVKKFVRILVSSVAFRIFGIFLVILDVFLVVVDLNVSEKKI
YIPLDYRSISLAIALFFLVDVLLRVSVEGRRRYFSDVLNTLDAVVIGVTVVVAVIYALYD
KHFLRDIPRLAVLLRPLRLLILIRILQLAHQKRQLERLTRKLVSGNKRRYKKDGFDLDLT
YVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKHFHYRVR
RIMIDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRTGTMVCACLIASEIVL
NAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKLKINYQLTLPPKKVLVIKRLV
VYSIHGVGKGDGSDLEVQIIMWQETVFSFCNSRNCMIFHDPETDRAIINVFHCPALYDDV
KVKFLSPNLPKYYDDCPFFFWFHTSFIKNNRLYLPRNELDNTHKPKTWKIYGEKFAVEVD
FGEN
Download sequence
Identical sequences G5E8H5
NP_954866.2.92730 ENSMUSP00000076435 ENSMUSP00000076435 ENSMUSP00000076435 10090.ENSMUSP00000076435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]