SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083611 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083611
Domain Number 1 Region: 232-370
Classification Level Classification E-value
Superfamily SH2 domain 8.19e-27
Family SH2 domain 0.00046
Further Details:      
 
Domain Number 2 Region: 116-170
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-21
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 197-279
Classification Level Classification E-value
Superfamily SH3-domain 9.22e-21
Family SH3-domain 0.000031
Further Details:      
 
Domain Number 4 Region: 5-60
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083611   Gene: ENSMUSG00000066877   Transcript: ENSMUST00000086421
Sequence length 380
Comment pep:known chromosome:GRCm38:1:43445751:43570515:1 gene:ENSMUSG00000066877 transcript:ENSMUST00000086421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKPSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSFNGQIGWFPSNYVLEEADEAAAEAPSFL
SLRRGTALSNGQGARVLHVVQTLYPFSSVTEEELSFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHTPQISYTGPSASGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGRNKHFKVQLVDSVYCIGQRRFHSMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
Download sequence
Identical sequences O55033
ENSMUSP00000083611 NP_035009.3.92730 XP_021053686.1.100879 ENSMUSP00000083611 10090.ENSMUSP00000110392 ENSMUSP00000083611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]