SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087763 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087763
Domain Number 1 Region: 315-414
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.56e-33
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 450-563
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087763   Gene: ENSMUSG00000026014   Transcript: ENSMUST00000090293
Sequence length 716
Comment pep:known chromosome:GRCm38:1:60490412:60566769:-1 gene:ENSMUSG00000026014 transcript:ENSMUST00000090293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSDKPKEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQVTEPKVPQK
LPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQASLSMDEAAQQSLVEDPK
PLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSLDIDKVTRPQELDLTTHQG
QPITEHAISLSCPSKQAKHHSDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQ
AAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCG
YSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYL
LGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYY
VPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDCCLALKHPQIQKKSQYIKYLCC
DDARTLHQWVNGIRIAKYGKQLYTNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQ
SNHSNQSDSGVSDTLPTGHIRSQSTVSSIFSEAWKRGTQLEESSKVTHKHYFTYKSVSSS
VQKPVPFIPLLQSHLVPFHWSFLGETILALSTVTCASLRSSFFMSVIYTLLLLPPP
Download sequence
Identical sequences ENSMUSP00000114596 ENSMUSP00000087763 10090.ENSMUSP00000114596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]