SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090829 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090829
Domain Number 1 Region: 38-463
Classification Level Classification E-value
Superfamily Ras GEF 9.02e-111
Family Ras GEF 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090829   Gene: ENSMUSG00000020374   Transcript: ENSMUST00000093142
Sequence length 469
Comment pep:known chromosome:GRCm38:11:49901855:49980215:1 gene:ENSMUSG00000020374 transcript:ENSMUST00000093142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMPRTLTASDMVTPGSLSPPPTESTEGEQAGQPLLDGAPSSASLDTLIQHLVPTADYY
PEKAYIFTFLLSSRLFIEPRELLARVCHLCIEQQQLDKPVLDKARVRKFGAKLLQLLAEW
TETFPRDFEEESTIGHLTDVVGRISPCDETYGSRVHQLLQTLHQKLASLGQGPESLVGAD
KPISYRTKPPASIHRELLGVCSDPYTLAQQLTHVELERLRHIGPEEFVQAFVNKDPLAGT
KPRFSDKTNNVEAYVKWFNRLCYLVATEICMPAKKKQRAQVIEFFIDVARECFNIGNFNS
LMAIISGMNMSPVSRLKKTWAKVKTAKFFILEHQMDPTGNFCNYRTALRGAAHRSLTAHS
SREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVECPFEQ
DPSITHYLYTAPIFSEDGLYLASYESESPESQTEKERWKSLRSSILGKT
Download sequence
Identical sequences 10090.ENSMUSP00000065619 ENSMUSP00000065619 ENSMUSP00000065619 XP_006534442.1.92730 ENSMUSP00000090829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]