SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096471 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096471
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-40
Family DNase I-like 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096471   Gene: ENSMUSG00000096463   Transcript: ENSMUST00000098874
Sequence length 499
Comment pep:novel chromosome:GRCm38:14:73661225:73662721:1 gene:ENSMUSG00000096463 transcript:ENSMUST00000098874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKQESNPSTNQKEDSHKNRMPTLTTEIKGSNNYFSLISLNINGLNSPIKRHRLTDWLHKQ
DPTFCCLQETHLREKDRHYLRVKGWKTIFQAKGLKKQAGVAILISNKIDFQPKVIKKDKE
GHFILIKGKILQKELSILNIYAPNARAATFIKDTLVKLKAHIAPHTIIVGDFNTPLSSKD
RSWKQKLNRDTVKLTEVMKQMDLTDIYRTFYPKTKGYTFFSAPHGTFSKIDHIIGHKTGL
NIYKDIEIVPCILSDHHGLRVIFNNNINNGKPTFTWKLNNTLLNDTLVKEGIKKEIKDFL
EFNENEATTYPNLWDTMKAFLRGKLISLSASKKKRERAHTSSLTTHLKALEKKEANSPKR
SRRQEIIKLRVQINQVETRTIQKINQTRSWFFEKINKIDKPLARLTRGHRDNILINKIRN
EKGDITTDPEEIQNTIRSFYKRLYSTKLENLDEMDKFLDRYQVPKLNQGQVNDLNSPISP
KEIEAVINSLPVKKGPGPD
Download sequence
Identical sequences L7N228
ENSMUSP00000096471 ENSMUSP00000096471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]