SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103044 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103044
Domain Number 1 Region: 109-271
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-34
Family DnaQ-like 3'-5' exonuclease 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103044   Gene: ENSMUSG00000030609   Transcript: ENSMUST00000107421
Sequence length 336
Comment pep:known chromosome:GRCm38:7:78895934:78908374:1 gene:ENSMUSG00000030609 transcript:ENSMUST00000107421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGEVPESTQCPSLTSLNTKDVVRRRHKRRSRQHQRFMARKALLQEQELLSTAPGPGLC
LLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRPGPIKCVAIDCEMVGTG
PQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHKAIPFQVAQKEI
LKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQPSSLIRTRVSLKDLALNL
LHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQAPAEDRGPDSSTDVEQYMD
DQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP
Download sequence
Identical sequences Q9CZI9
ENSMUSP00000103044 ENSMUSP00000103046 ENSMUSP00000103048 ENSMUSP00000103046 NP_080807.3.92730 XP_006541200.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]