SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111061 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111061
Domain Number 1 Region: 133-227,270-382,416-522
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.01e-36
Family LacY-like proton/sugar symporter 0.034
Further Details:      
 
Domain Number 2 Region: 550-604
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 3 Region: 647-761
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000523
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111061   Gene: ENSMUSG00000025938   Transcript: ENSMUST00000115402
Sequence length 850
Comment pep:known chromosome:GRCm38:1:12871348:12991177:-1 gene:ENSMUSG00000025938 transcript:ENSMUST00000115402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGDAQSRAQQQLEAPSSVGAVQEKCESESFRSKSLPVLHSASCRQNFSAGNADGKLAL
GCNEAPGRQETHLGRNLIVPSPSAPSTSAGTTTELMDCNHRMDPSKTVSVSSTLATLQER
RCLYVVLTDSRCFLVCMCFLTFIQALMVSGYLSSVITTIERRYSLKSSESGLLVSCFDIG
NLVVVVFVSYFGGRGRRPLWLAVGGLLIAIGAALFALPHFISPPYQIQELNASASNDGLC
QNGNSTAILEPPPCPKDSGGNSHWIYVALFVCAQVLIGMGSTPIYTLGPTYLDDNVKKDN
ASLYLAIMYVMGALGPAVGYLLGGLLIGFYVDPRNPVHLDQSDPRFIGNWWSGFLLCAIA
MFLVIFPMFTFPKKLPPRHKKKKKFSADVVIDDDIIKEKSNTSEQMNKKVSPMGFGKNVR
DLPRAAVRILSNMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIV
PSAGVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYT
TGPSLTMPHRNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCINSGNLTTGVRNYT
ECTCVQSRQVITPPTVGQRSQLRVVIVKTYLNENGYAVSGKCKRTCNTLIPFLVFLFIVT
FITACAQPSAIIVTLRSVEDEERPFALGMQFVLLRTLAYIPTPIYFGAVIDTTCMLWQQE
CGVQGSCWEYNVTSFRFVYFGLAAGLKFVGFIFIFLAWYSIKYKEDGLQRRRCREFPLST
VSEQVGQPSKAEKYSRTTSCPAFSTQGEVHEETALQKGFPCTTQTYPGPFSEAVSSSADP
GQDESPDAAL
Download sequence
Identical sequences E9PVD9
ENSMUSP00000111061 ENSMUSP00000111062 10090.ENSMUSP00000111062 ENSMUSP00000111062 ENSMUSP00000140091 NP_766429.2.92730 XP_011236682.1.92730 XP_011236683.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]