SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112930 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112930
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 5.68e-36
Family Osteonectin 0.0097
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.05e-28
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 138-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000236
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112930   Gene: ENSMUSG00000054162   Transcript: ENSMUST00000119068
Sequence length 436
Comment pep:known chromosome:GRCm38:8:62951361:63357103:1 gene:ENSMUSG00000054162 transcript:ENSMUST00000119068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVSALLCVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHS
MKEVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCE
GRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDE
DEGDDDDDGDVHDGYI
Download sequence
Identical sequences Q8BKV0
ENSMUSP00000091192 ENSMUSP00000112930 ENSMUSP00000113683 NP_001239549.1.92730 NP_076178.1.92730 ENSMUSP00000091192 ENSMUSP00000112930 10090.ENSMUSP00000113683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]