SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114531 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114531
Domain Number 1 Region: 37-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-35
Family SCAN domain 0.00007
Further Details:      
 
Domain Number 2 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 403-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 655-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 696-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 161-220
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 9 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 505-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114531   Gene: ENSMUSG00000005267   Transcript: ENSMUST00000149228
Sequence length 759
Comment pep:known chromosome:GRCm38:11:62711251:62728673:-1 gene:ENSMUSG00000005267 transcript:ENSMUST00000149228 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MANSSLSQVLLMWKPGKIQKGPCSAEQQTLTSRLLRDTETCRRNFRNFPYPDVAGPRKAL
CQLRELCLKWLRPEVHSKEQILELLVLEQFLSILPGEVRTWVNSQYPESSEEVVALVEDL
TQILEEEEAPQSSALPQDTPEDDPNHDPNPASQAGWLSDVVTKDLVTFNDVAVDITQEDW
ELMPPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPVLEEPWMVIKEIVEGPNPEWEPKA
QAQCPAKHLPELKQDGTQTVKLEDSYDDDNDDSVESPPVCAFGMIHIDEEGFSVKSELSQ
EDPTEEYLSKCDIYRVTFEKHTNLGVQFDTQSDDKTALYNESKPPFSNASSGGAVRGKIL
PGDKPYSCNVCGKQFRKYPSLLAHRENHAKEKAYECEECGKEFKHLSSLIAHQRMHTGEK
PYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCEDCGKDFSQRAHLTIHQRTHTGEKPYKC
LECSKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECW
KVFSQSTYLIRHQRIHSGEKCYKCTACGKAFAHSSTLIQHQTTHTGEKSYICNVCGKAFS
QSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNTCGKAYRQGAN
LTQHQRVHTGEKPYKCHHCGKAFIYSSSLNQHRRTHTGERPYKCSHCNKDFSQRTCLIQH
QRIHTGEKPYGCRICGKAFTQSTNLIQHQRVHTGARHRN
Download sequence
Identical sequences Q9EQB9
ENSMUSP00000114531 ENSMUSP00000114531 ENSMUSP00000141046 ENSMUSP00000114531 NP_573471.2.92730 XP_006532443.1.92730 10090.ENSMUSP00000114531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]