SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117880 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000117880
Domain Number - Region: 535-671
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0107
Family Neurolysin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117880   Gene: ENSMUSG00000005611   Transcript: ENSMUST00000142368
Sequence length 921
Comment pep:known chromosome:GRCm38:7:110923860:110982058:-1 gene:ENSMUSG00000005611 transcript:ENSMUST00000142368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNQRAHLWLLDPGNGTQFGTGMGRSLTCPFGISPACGAQASWSIFGVGTAEVPGTHSHS
NQAAAMPHIPEDEEPPGEPQAAQTQDSPSAGPFPSPPTIVLTGDASSPEGETDKNLVNRA
PSPHRRLSHRHLKVSTASLTSVDPSGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVS
ERFLTRRGRKSRSSLGDSPSAVSPNLSSGASPASSRSCSLTISTSPGLDICSGPQSPLPG
APPQQKGHEDGVSSPCPGEPNVSKGLADLKQNDQRKVSQGRLAPRSPTVEKTKELTVEQK
ENFDPLQHVEATPMAQASGASISGKMALNSPQPGPAEMELGRQLLKTAREGNPLPRTTAQ
GSGGTVSPHSLGQGSAGEPMGPKAGSKAELRSPVSRPPLIRGVSWDSSPEEPGPLLQKVL
AKLPLAEEEKRFPGKAKPAKPPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGFKLP
ELSEAAEQDKGVSPELAPAAEEEESKSGLDVMPNISDILLRKLRVHKSLTGSAPPLTEKE
VENVFVQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSANIWYHCEH
RETYQKLLEDIAVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHA
ELMEFKKLANQNSSRSCGPSEDGVPRTARSMSLTMGKNMPRRRVSVAVVPKFNALNLPGQ
APSSSPMPSLPALSESSNGKSSISVSPALPALLENGKTNAEANCEVGAPVPLPSCLEETS
QETKAKAEEEAYSKGYQEGVKKTEELQDLKEEEEEEQKTESPEEPEEVEETQEDEKDQGS
SKLEELVHFLQVMYPKLCQHWQVIWMMAAVMLVLSVVLGLYSSYNSCTEEADGPPGRSTC
SAAQRDSWWSSGLQQELPAEQ
Download sequence
Identical sequences G5E8V5
ENSMUSP00000114578 ENSMUSP00000117880 10090.ENSMUSP00000114578 NP_034956.2.92730 ENSMUSP00000114578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]