SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118751 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118751
Domain Number 1 Region: 727-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.99e-54
Family Ankyrin repeat 0.000045
Further Details:      
 
Domain Number 2 Region: 448-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-45
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 221-409,440-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.06e-44
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 4 Region: 48-157
Classification Level Classification E-value
Superfamily POZ domain 9.94e-22
Family BTB/POZ domain 0.0064
Further Details:      
 
Domain Number 5 Region: 1104-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118751   Gene: ENSMUSG00000020790   Transcript: ENSMUST00000155998
Sequence length 1169
Comment pep:known chromosome:GRCm38:11:72690006:72772146:1 gene:ENSMUSG00000020790 transcript:ENSMUST00000155998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCTLLAAQANKENSNESFISRLLAIVAG
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTEEIDLSDANPEVTMTMLRW
IYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSLSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNETDHNGDLALDLALSRRLESIATTLVSHKADVDMVDKNGWSLLHKGIQRG
DLFASTFLIKNGALVNAATAGAQETPLHLVALYSPKKYSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHLSIMARNDCVFSQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQSV
NPFEDLPVVNGTSFDENSFAARLIQRGSNTDAPDVMTGNCLLQRAAGAGNEAAALFLATS
GAHANHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPVPKESPVLMSSADS
IYLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQ
LAIKHQLPLVVDAICTRGADMSVPDEKGNPPLWLALASNLEDIASTLVRHGCDATCWGPG
PSGCLQTLLHRAVDENNESTACFLIRSGCDVNSPRQPGTNGEGEEEARDGQTPLHLAASW
GLEETVQCLLEFGANVNAQDAEGRTPVHVAISNQHSVIIQLLISHPNIELSVRDRQGLTP
FACAMTYKNNKAAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLE
NGVDFAAVDENGNNALHLAVMHGRLNNIRALLTECTVDAEAFNLRGQSPLHILGQYGKEN
AAAIFDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRSGVRLGVNNNQGVNI
FNYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTK
EIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences Q810B6
ENSMUSP00000118751 NP_033801.4.92730 10090.ENSMUSP00000118751 ENSMUSP00000118751 ENSMUSP00000118751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]