SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122271 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122271
Domain Number 1 Region: 1148-1343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 
Domain Number 2 Region: 938-1061
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-31
Family Pleckstrin-homology domain (PH domain) 0.000000589
Further Details:      
 
Domain Number 3 Region: 42-167
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122271   Gene: ENSMUSG00000036591   Transcript: ENSMUST00000140230
Sequence length 1955
Comment pep:known chromosome:GRCm38:2:20889900:20943419:-1 gene:ENSMUSG00000036591 transcript:ENSMUST00000140230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATHWTGLPEEDGDKLKACGAASACEVSKNKDGKDQGEPVSPSEDEPFSWPGPKTVMLK
RTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAF
EAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTA
LAYSQDAYLKGNEAYSGNARNIPEPPPVCYPWLPSTPSATAQPVETCPPDSLPNKQQTSA
PVLTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLANRNNPSGP
SHRTEEVRYGVNEQASTKAASRTTSPASVPTAHLIHQTTGSRSLEPSGILLKSGNYSGHS
EGISSSRSQAVDSPPVSVNHYSANSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSL
RAASQSAADYNQVVPTRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRS
ASQGALTSPPVSFNNHRTRSWDYIEGQTEATATVNSESQIPDSNGERKQTYKWSGFTEQD
DRRGIHERPRQQEMHKPFRGSNLTVAPVVNSDNRRLVGRGVGPVSQFKKIPPDLRPPHSN
RNFPTTTGVSLQRGIAQDRSPLVKVRSNSLKVPPPPVSKPSFSQHSLASMKDQRPVNHLH
QHSVLSQQTQFRSESTFEHQLETEVSSCLPGTSAKTSPQLSENLGTSDLELPAIPRNGDI
NLQEAEIQQPDVLDNKESVILREKPQSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPND
ARREVHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHEIAHIPASAVISASTAHVP
SIATVPPSLTTSAPLIRRQLSHDQESVGPPSLDGQHSSKTERSKSYDEGLDDYREDAKLS
FKHVSSLKGIKITDSQKSSEDSGSRKGSSSEVFSDAAREGWLQFRPLVTDKGKRVGGSIR
PWKQMYVVLRGHSLYLYKDRREQTTPSEEEQPISVNACLIDISYSETKRRNVFRLTTSDC
ECLFQAEDRDDMLSWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLLSKTEQLPKTPR
QSLSIRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRRGIPSIVRKTFE
KKPAATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQ
EELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRL
RTLKRLIHDLPEHHFETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTH
MVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTG
VLPGDVSDSATSDSAKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDE
LDSVFFKKENTEQSHSEIKEESKRESETSGSKQRVVVAKESNTKKDSGTTKEEKKIPWEE
PSPPHSSKRNRSPTLSCRLAMLKEGPRSLLTQKPHCEETGSDSGTLLSTSSQASLLRSST
KKSTSPETKHSEFLSIAGTTTSDYSTTSSTTYLTSLDSSRLSPEVQSVAESKGDEADDER
SELVSEGRPVETDSESEFPVFPTTLTSDRLFRGKFQEVARVSRRNSEGSEASCTEGSLTP
SLDSRRQQFSSHRLIECDTLSRKKSARFKSDSGSPGDTRTEKETPALAKMFDVMKKGKST
GSLLTPSRSESEKQEATWKTKIADRLKLRPRAPADDMFGVGNQKPTAETAKRKNIKRRHT
LGGHRDATEISVLSFWKAHEQSADKESELSAVNRLKPKCSAQDLSISDWLARERVRTSAS
DLSRGEGLEPQAESPSVLGTPISTHSPPSQQPEARVAATSTLASTSQSPLFTPPQSPDQI
NRESFQNMSQNASSTANIHPHKQSESPDTKAETPP
Download sequence
Identical sequences B7ZCJ1
ENSMUSP00000122271 10090.ENSMUSP00000122497 NP_001121556.2.92730 XP_006497606.1.92730 ENSMUSP00000120357 ENSMUSP00000122497 ENSMUSP00000122497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]