SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128608 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128608
Domain Number 1 Region: 601-741
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-32
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.96e-27
Family PLC-like (P variant) 0.000000976
Further Details:      
 
Domain Number 3 Region: 1437-1567
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-23
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 4 Region: 468-527
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128608   Gene: ENSMUSG00000028456   Transcript: ENSMUST00000163653
Sequence length 1609
Comment pep:known chromosome:GRCm38:4:43059073:43263622:1 gene:ENSMUSG00000028456 transcript:ENSMUST00000163653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRLPQQLFLQGSSHDSCNDSM
QSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYHEQDDDGRERDSIHSSHSYG
SLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATIHPPSDLVLHKDHVLGPQESL
PEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQEQPLEEPGPS
IRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALEE
HEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSL
EFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRF
AKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAA
DSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPNARASVAQD
ADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPPLTDQTGTQL
ILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKS
PDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIRPEKGAGVDDPVGE
VSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKS
KSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSC
ACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSTEEGS
Download sequence
Identical sequences E9Q263
ENSMUSP00000128608 ENSMUSP00000103587 XP_006537858.1.92730 ENSMUSP00000103587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]