SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|409249519|ref|YP_006885344.1| from Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409249519|ref|YP_006885344.1|
Domain Number 1 Region: 45-158,193-367
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-29
Family Kelch motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|409249519|ref|YP_006885344.1|
Sequence length 382
Comment N-acetylneuraminate epimerase N-acetylneuraminate mutarotase; Neu5Ac mutarotase; Sialic acid epimerase; Flags: Precursor [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
Sequence
MKNFKKMMTLMALCLSVAITTSGYATTLPDIPEPLKNGTGAIDNNGVIYVGLGTAGTSWY
KIDLKKQHKDWERIKSFPGGAREQSVSVFLNDELYVFGGVGKKNSESPLQVYSDVYKYSP
VKNTWQKVDTISPVGLTGHTGVKLNETMVLITGGVNEHIFDKYFIDIAAAAADESEKNKV
IYNYFNKPAKDYFFNKIVFIYNAKENTWKNAGELPDAGTAGSSSVMENNFLMLINGELKP
GLRTDVIYRAMWDNDKLTWLKNSQLPPSPGEQQQEGLAGAFSGYSHGVLLVGGGANFPGA
KQNYTNGKFYSHEGINKKWRDEVYGLVNGHWQYMGKMKQPLGYGVSVSYGDEVFLIGGEN
AKGKPVSSVTSFTMRDGNLLIK
Download sequence
Identical sequences A0A2I6TM92
272994.SPAB_02408 ABFF01000014|CDS_59015-57867 CP000886|CDS_1988577-1987429 gi|161614657|ref|YP_001588622.1| gi|409249519|ref|YP_006885344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]