SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83312823|ref|YP_423087.1| from Magnetospirillum magneticum AMB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83312823|ref|YP_423087.1|
Domain Number 1 Region: 847-1009
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.11e-41
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 351-477
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-21
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 3 Region: 474-647
Classification Level Classification E-value
Superfamily GAF domain-like 2.16e-19
Family GAF domain 0.0075
Further Details:      
 
Domain Number 4 Region: 645-767
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-17
Family Heme-binding PAS domain 0.047
Further Details:      
 
Domain Number 5 Region: 775-855
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.67e-17
Family Homodimeric domain of signal transducing histidine kinase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83312823|ref|YP_423087.1|
Sequence length 1012
Comment sensory histidine protein kinase [Magnetospirillum magneticum AMB-1]
Sequence
MTHPPSSPSSAGPTTSAPNAQDQRDSDARRFTRRLVSAVLALNLFVGALVASVLVMSRSQ
HRHQAMAVADNLSTVLRTNLHGTIAKIDLTLLAVADEIARQERVGGVDAAQIEDLLRRHD
ERLPEALGLRVVDASGIIRYGVTGIKVAQASIADRPQFIKMRDDPKAGLVISKPVLGRAA
QTWMVTLSRRLNAPDGSFAGDVHVALPLDKFTESFSAIDVGPQGSVSLWDDGPSILARAP
ELDGPGGVVAKAPKPSPQLLSLIQSGTGKAAYHADSNVDGVARSYHLSRIGSFPLWVIVG
LSEDDYLADWRRQALIMVAVAMGFSLLSVTVATLLLRSWRNRHAAARALEAAHVQTEEAR
HRLELILASAGEGICGVDPEGRITFINPAARRMLGWSETEGVGLNLHEEVHHHRADGSEF
PAVACPVWQTLHDGNIRHVPRDVHWRRDGTPVTVEFTTAPIIQNGRVAGAVTLFRDIARR
IRAESEAARNLAVTTALGGILRHSLEDRRLNDILHDSLVEILSLPWLNVEERGAIFLAQP
DGKTLALVAEHNMSQAIIQACTVIRMGNCLCGAAAERREAVFASHVDERHQTQVPDMHPH
GHYCIPIMNGPDLLGVLNTYIGHGHPWQKEEEHFLRMVADTLAGIIRRKQIEETLRNSEE
LSKTLLNATIDGALLMTPEGRILATNEALAARFATTPAQMPGTSFFDWLPQPLAERRRDQ
FAQVLADRRPLHSVDERGGAIFDNRIYPVQDGDGEIRRMAVFSRDVTEQRHAQKAIEKAL
ADLARSNAELEQFAYVASHDLREPLRAITGHLQLLQRLAKDKLDDYALESLLFAVDGARR
MDLLIRDLLDYSRIGHADREMEDLDLGEVIADALSNLSAAIAEGHATVTTATGMPHAHGN
RMELTRLFQNLIGNALKYRNPERPPEVELRAVRVGGAWDISIRDNGIGIEPEYFNRIFMI
FQRLHGRGQYEGTGIGLAVCRKIVDRHGGSIRVESEPGKGSTFTVTLPVIGG
Download sequence
Identical sequences Q2W0U7
WP_011386080.1.61852 342108.amb3724 gi|83312823|ref|YP_423087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]