SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601381|ref|YP_501559.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601381|ref|YP_501559.1|
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88601381|ref|YP_501559.1|
Sequence length 116
Comment anti-sigma-factor antagonist domain-containing protein [Methanospirillum hungatei JF-1]
Sequence
MEDHLSIQEREISGITILDISGRIDAATSSQIEGELGKKIDTGVTTLILNMKDLSYISSS
GLRVILAALKRVKAEEGTIALATLQPGPGEVFKMTGFDRLFPISPSVEQAVEKLKS
Download sequence
Identical sequences A0A1V5SZP6 Q2FMI4
WP_011447137.1.85653 gi|88601381|ref|YP_501559.1| 323259.Mhun_0062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]