SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601465|ref|YP_501643.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601465|ref|YP_501643.1|
Domain Number 1 Region: 143-253
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0054
Further Details:      
 
Domain Number 2 Region: 19-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000612
Family Heme-binding PAS domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601465|ref|YP_501643.1|
Sequence length 299
Comment PAS/PAC sensor protein [Methanospirillum hungatei JF-1]
Sequence
MSTRTLNVDPFEIIQSIDEPLFVLNEKYAVVFGNRAFDQTFGVNRADIEGRSVYEIGNGI
LNIPVIRQTLESLKNAGNEVKHFEVEIPIPQGKKTFIVKAGVMRRYGSSNEDQILVRFED
ISDQLAAEISIREKNAAILELSTPITKIWDEILVLPMIGTLDAERANKMIEQLLDAISRE
RARSIIMDGTGITHIDEMVATHIIKATTAVKLLGSQVIMTGVKPEVAMMMVKLGIDLKDI
VTRATLQEGVQYALDSRGYMVVSKSSIMSEEQTFQTAAPRQNGQSAKPTIRIVNPYREP
Download sequence
Identical sequences A0A1V5SX66 Q2FPH6
323259.Mhun_0148 gi|88601465|ref|YP_501643.1| WP_011447220.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]