SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601500|ref|YP_501678.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601500|ref|YP_501678.1|
Domain Number 1 Region: 98-410
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 3.02e-48
Family TM0189-like 0.015
Further Details:      
 
Domain Number 2 Region: 33-92
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000249
Family Type I dockerin domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601500|ref|YP_501678.1|
Sequence length 426
Comment periplasmic binding protein [Methanospirillum hungatei JF-1]
Sequence
MKKWCIYGGVLLTLLTLCCLTTTGSASGMEFTLYIFGNANSDMNIDQQDIDLINEIAAGK
TASTPLADANQDGKVDSADAEQVQKIIDGTATEMWVQDAFKQPVKVKTPVQRLITLDRMI
AENAQVIGVGDKIVGIDENTVNRDIILPTISKQKNLGSAEEPDMEALIALKPDLIVNNQY
FDEGLMKKLQESGLTPLAMIYHGDIQNSLGYSKMLGYLTGSPSTAEEYVNWMGGTLGSIH
DKVAGLSEDEKTKVIYLYPRKNGALGSGGNDCPTIKTLQFLGADTMTQNTKDTAGKIMDT
ASYFEIDPEVVIAKNPEAIVMEDFDEALGYGYTDKNAAQAELDRIKSRPGFDKLDAVKNN
KVYLLDVNIVSHSNCLGALYMAKALYPDQLSDIDPYAIHQEYVDRFLKVPGLDVKKDGIF
IYPQIS
Download sequence
Identical sequences Q2FMP6
323259.Mhun_0185 gi|88601500|ref|YP_501678.1| WP_011447254.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]