SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601627|ref|YP_501805.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601627|ref|YP_501805.1|
Domain Number 1 Region: 144-252
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-18
Family FHA domain 0.0021
Further Details:      
 
Domain Number 2 Region: 19-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000173
Family Hypothetical protein PH1932 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601627|ref|YP_501805.1|
Sequence length 260
Comment ArsR family transcriptional regulator [Methanospirillum hungatei JF-1]
Sequence
MTWVPDMTDNTIQGKRDPEYLIEMSEYLNALANPVRLQILSSLETRPMELKEIAAITRTS
YENIRKHIDKLLLAGLVRKDAGMSSETMTGIHPVWKYSLAPGGMEQIITNLSMFSKVSLM
ITHTDLATQLSTLRKDISTQFGVTSPCLYLTTGPEEGKVFSLNGDKIPLGRVDPTDMSFS
KMQSSVVMLSSEYKSVSRISRPHARIYHGNVWEIEDCGSTSGTFVNTEPISPHTRRTITD
GDLIILGTGNMSARFLFITD
Download sequence
Identical sequences Q2FPV7
WP_011447381.1.85653 gi|88601627|ref|YP_501805.1| 323259.Mhun_0316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]