SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601945|ref|YP_502123.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601945|ref|YP_502123.1|
Domain Number 1 Region: 148-466
Classification Level Classification E-value
Superfamily Subtilisin-like 1.14e-77
Family Subtilases 0.0000018
Further Details:      
 
Domain Number 2 Region: 496-546
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000275
Family Type I dockerin domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88601945|ref|YP_502123.1|
Sequence length 547
Comment peptidase S8/S53 subtilisin kexin sedolisin [Methanospirillum hungatei JF-1]
Sequence
MQFAHFRYLLTLIILTGLSFSGLISGVYADEVSESSNGTGESAPAPYVPGEVIVKYKDGT
VAALAAEGSGPVALEALGAEVATDFSAEGLSNLQALDITGPVSVKEAIAELESSPYVAYA
EPNYIISLSLPETEPAGPDEIGALSALSFPNDPKFSDQWGLFNTGQTGGISGADIGASKA
WDITTGSNAIVVAVIDTGVDYNHPDLAGNIWTNPGEIPNNGIDDDGNGYVDDVHGYDFIN
NDNDPMDDNGHGTHCAGVIGAIGNNGVGIAGVAWKVKIMPLKFLRADGNGDTAASLNAIA
YARRMGANVISCSWGGTAKSQALGDAIASTNILFPCAAGNAGSNNDITPHYPSGFDSPQI
ISVAASDAKDGIPSFSNYGATTVDVAAPGDWIMSTYPTSLGHQYVKMKGTSMATPHVAGL
AALLLSKNPSMTPAALKAKIMDTVDKLPAFSGKTVSGGRINVYKALGGGGSSSGVVALPG
MSQPPKDLNGDGKYEDVNGNGRADYSDVVTFFKQMDWISKNEPVAAFDFSGNNRIDYTDV
VKLFQSI
Download sequence
Identical sequences Q2FLC3
323259.Mhun_0648 gi|88601945|ref|YP_502123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]