SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602144|ref|YP_502322.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602144|ref|YP_502322.1|
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily Aquaporin-like 6.41e-57
Family Aquaporin-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602144|ref|YP_502322.1|
Sequence length 250
Comment MIP family channel protein [Methanospirillum hungatei JF-1]
Sequence
MSLLQRCVAEGVGTGILVYFGAGAAAITLMIAHGTNPSTEFNIGIGVLGGLGDWFAIGMS
FAIAIAGCIYALGRVSGCHINPAVTIALGVTKRFPAEEIIPYVIAQCLGAVLGSLLFAAT
VGMDAVLIGGLGATAPFPGISYGQAILAEAIGTFLLMLVIMGVAVDNRAPPGFAGLIIGL
TVGGIITATGNIAGASLNPARTFGPYLADLVLGGSNLWIYFPIYVIGPVIGAVVAVLLYA
YLTSEIEEST
Download sequence
Identical sequences A0A1V5SXT8 Q2FQL7
gi|88602144|ref|YP_502322.1| 323259.Mhun_0851 WP_011447882.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]