SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602258|ref|YP_502436.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602258|ref|YP_502436.1|
Domain Number 1 Region: 53-344
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.37e-26
Family Galacturonase 0.067
Further Details:      
 
Domain Number 2 Region: 429-662
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.3e-17
Family Chondroitinase B 0.031
Further Details:      
 
Weak hits

Sequence:  gi|88602258|ref|YP_502436.1|
Domain Number - Region: 330-442
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000251
Family Galacturonase 0.053
Further Details:      
 
Domain Number - Region: 667-719
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000647
Family Type I dockerin domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602258|ref|YP_502436.1|
Sequence length 720
Comment periplasmic copper-binding protein [Methanospirillum hungatei JF-1]
Sequence
MDIIQNTYNLKRLFKIKFVIIFTIFLLYISGFSFGDDTFDENILITYPVTLEKPGVYYLN
ESVFINDSAIHITHSDIILDGHGNIVTGNMSSGSIGITIQHPEMMMHNITIRNITIRDFE
TGILIDTSHEINLEKADLISHMRTGIRIETSENIQITRCTVQNNRNEITGGYGIQISDSN
KIKITNSQVTGNGKTGKSNSGGIYITNSSETSIISSQISTNPGFGIRADNGTEHLKISDC
DISVNSGDGILIQSGSSPDIQKSILDKNKESGIELIKVVQPVITGNVITSGTMGISLLDT
EDMTLTGNSLKNNRIGFDISASDIRYYNHHISNTNTIDSRTLIYLKDVRDRKIGPSMNPS
MVIIVNSSDIALSELVLSKNCAGIILANSSNLTLTDISFIENGIGIRSEFGTNNLICNNL
HAERNLVSGYYISNTNNFTLTSIYGQESPSGIYLHNATGGILKNIYMTQITGLKSRMPSG
ITLSGCDSITVSKSQFSECSYAGLVSDSDNLNLTDNRFLSNTYAGSVILSGPVDLYNNSF
LNNEDTGLILRANQSTILRNTFTNNKNRGILLISGNENLFAYNTFKNYKNCMIQDKNAIN
IWNTSNMYFSDNTYPAGNYWGDPEGEGFSDICTTDPNGCCIDPYIIQLYNIDYHPLSSQY
IIESTMNTDLNQNGREDLQDVVKYMNMVSSGDTSSLYDFSGDGKINLNDVVSLFHIIIKK
Download sequence
Identical sequences Q2FPE3
gi|88602258|ref|YP_502436.1| WP_011447996.1.85653 323259.Mhun_0967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]