SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602383|ref|YP_502561.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602383|ref|YP_502561.1|
Domain Number 1 Region: 81-278
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000000455
Family Terpene synthases 0.098
Further Details:      
 
Weak hits

Sequence:  gi|88602383|ref|YP_502561.1|
Domain Number - Region: 7-62
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0022
Family Terpene synthases 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602383|ref|YP_502561.1|
Sequence length 280
Comment hypothetical protein Mhun_1093 [Methanospirillum hungatei JF-1]
Sequence
MLSEGEKEKTIRYISDRRCQSGGYCFYQLDEPNLSDTWYALGCLEVLQAAFSDNLTQEYL
SRFVNQTRGLSGLYRLWYLFWSFRYLKRTIPEQLIAHLLACPVPTIFHSGTIESASLFEP
LYCYVILCEEAGIQHSESERKKIQEEVLRWQHPSGGFGRDKATLIETRHAVAILQGFHIE
TDAERIYSFLTRCIDEQSGFVNVPSSHPGYLEHLDAGIALAKLLSRPVPNRYQCLLYLDK
CRNTNGGYARSGFGGNSTLEYTWYAIRSLCGLHNKTGWNW
Download sequence
Identical sequences Q2FQ78
WP_011448120.1.85653 323259.Mhun_1093 gi|88602383|ref|YP_502561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]