SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602394|ref|YP_502572.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602394|ref|YP_502572.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Vng1086c-like 4.71e-30
Family Vng1086c-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602394|ref|YP_502572.1|
Sequence length 94
Comment hypothetical protein Mhun_1104 [Methanospirillum hungatei JF-1]
Sequence
MHKEELISLHTMLTNVREYLQEQNPDADFTEYDALEITPSQTHRSKIEHKYAIFVLGNAI
AKAMREVDNPSAARMADRMHELAERTLKEIEMEG
Download sequence
Identical sequences A0A1V5SJW3 Q2FLB1
gi|88602394|ref|YP_502572.1| WP_011448131.1.85653 323259.Mhun_1104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]