SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602731|ref|YP_502909.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602731|ref|YP_502909.1|
Domain Number 1 Region: 157-429
Classification Level Classification E-value
Superfamily Subtilisin-like 9.3e-76
Family Subtilases 0.00000267
Further Details:      
 
Domain Number 2 Region: 425-511
Classification Level Classification E-value
Superfamily PKD domain 1.7e-21
Family PKD domain 0.00059
Further Details:      
 
Weak hits

Sequence:  gi|88602731|ref|YP_502909.1|
Domain Number - Region: 541-593
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00392
Family Type I dockerin domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88602731|ref|YP_502909.1|
Sequence length 594
Comment peptidase S8/S53 subtilisin kexin sedolisin [Methanospirillum hungatei JF-1]
Sequence
MERVSVSWILRACLLFMLITAVWGGVQAEQGSDYVPGEVIVRYANLGSGTAVASVASSLN
AQIGAETIYTDEVMGINGMQVVKVPDTISVPDAVQFYKSNEHVLYAEPNYVITLPTPLGK
GENIIQGLDSETPGMTIPNDPDFDLQWGLYNTLNSSAGRADISAPEAWNISTGSSDVIVA
VVDSGVDYNHEDLAANCLKGFDFVNYDEDPMDDNGHGTHCAGIISAVTDNSIGIAGVSWN
SKILPVKVFDATGVSNTALEIMGIVYAKEQGANIISCSWGSHIYSEALKDAIDSTDALFV
CSAGNDGYDNDEIPYYPAGYNSAHIISVGASDEYDMLTWFSNYGAVSVDLLAPGQNIYST
LPGDYGFMDGTSMSVPFVSGTAALIKSEKPGYDAGQIKNLILNSVDQKFWLNSTCATGGR
LNAYKPLSLVLPLNADFKAEPVSGTIPLNVQFVDMSSGEPETWHWTFGDGFESTLQNPTH
LYMKPGKYSITLTISKEGLSSIAEKENFIHVKPPYQPVKAFPDGKGGFYPVPTDADDDGL
FEDINGNGWLEYEDPKLLFDQILFAMKEEPIGQFDFDKSGFIGFGDVVKLYQMV
Download sequence
Identical sequences Q2FNJ1
WP_011448459.1.85653 323259.Mhun_1456 gi|88602731|ref|YP_502909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]