SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88603391|ref|YP_503569.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603391|ref|YP_503569.1|
Domain Number 1 Region: 187-435
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.06e-118
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000152
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.61e-73
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603391|ref|YP_503569.1|
Sequence length 435
Comment methyl-coenzyme M reductase subunit beta [Methanospirillum hungatei JF-1]
Sequence
MAKFSDTIDLYDDQGKLLKSGVALDKVSPLTNAGIKKMISLTKRTVAVNLGGAEAFLKTG
KAGKNQIPGRELNLDLVANAGAIKEKMFKMLQVTEGDDTEIKEFGGGKLLLCTVPTARIE
AAATYDAAMTAVSAAATYAVIDQFNVDMFNGSTVKAAFWGTYPQTMDPSGSACASILSIP
QNNEGLGYALRNIQANHCVMITNKNAMQGAALSATFEQAGEFEMGAAIGPFERAQLLLYA
YQGLNANNLVYDLVKKNGATGTIGTVVQSLVERAIEDKVITPGKKGPSGYIFYETKDPML
WNAYTAAGTMAATMVNCGAGRFAQAVSSTLLYFNDLIEHETGLPGCDYGRVMGVAVGFSF
FSHSIYGGGGPGIFNGNHVVTRHAAGVGLPCIVAACALDAGTQMFSPESTSKVYQDTFGK
IPEFAQPIQHIAQGA
Download sequence
Identical sequences Q2FSD8
323259.Mhun_2144 gi|88603391|ref|YP_503569.1| WP_011449108.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]