SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88603697|ref|YP_503875.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603697|ref|YP_503875.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.4e-34
Family Canonical RBD 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88603697|ref|YP_503875.1|
Sequence length 105
Comment RNA recognition motif-containing protein [Methanospirillum hungatei JF-1]
Sequence
MEGKRLYVGNLTYSVKEDQLKDLFSQYGDVVSVKIIEQKGFGFVEMGTSEEAQAAMDALN
QTVFEGRTMRIDEARPMQPRREFDRGSGGGGYNRGRGYGGGRNYS
Download sequence
Identical sequences A0A1V5SQ04 Q2FSR7
323259.Mhun_2455 WP_011449414.1.85653 gi|88603697|ref|YP_503875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]