SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88603738|ref|YP_503916.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603738|ref|YP_503916.1|
Domain Number 1 Region: 1038-1117
Classification Level Classification E-value
Superfamily PKD domain 2.62e-23
Family PKD domain 0.00063
Further Details:      
 
Domain Number 2 Region: 932-1034
Classification Level Classification E-value
Superfamily PKD domain 9.03e-23
Family PKD domain 0.00097
Further Details:      
 
Domain Number 3 Region: 1189-1310
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000118
Family PKD domain 0.0015
Further Details:      
 
Domain Number 4 Region: 748-836
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000262
Family PKD domain 0.0042
Further Details:      
 
Domain Number 5 Region: 862-932
Classification Level Classification E-value
Superfamily PKD domain 0.000000000157
Family PKD domain 0.0032
Further Details:      
 
Domain Number 6 Region: 257-274,304-497
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000327
Family SGL-like 0.09
Further Details:      
 
Weak hits

Sequence:  gi|88603738|ref|YP_503916.1|
Domain Number - Region: 1476-1528
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000314
Family Type I dockerin domain 0.0074
Further Details:      
 
Domain Number - Region: 475-702
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000523
Family Serum paraoxonase/arylesterase 1, PON1 0.066
Further Details:      
 
Domain Number - Region: 1136-1210
Classification Level Classification E-value
Superfamily PKD domain 0.0255
Family PKD domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603738|ref|YP_503916.1|
Sequence length 1531
Comment hypothetical protein Mhun_2497 [Methanospirillum hungatei JF-1]
Sequence
MNRNISKGVLAALLCILLCCIVMADNQEINYTDISAHPVQFIENAGQAHEDILYQVKSSE
FSFDFTKDALLVSGPSGDCEECGENVTTPVIVTVADAEENVTVEAFDKLDGYANFLIGKN
ESDWQQYVPWYGGIRYREILPGIDLSYSGKQGVLKREFTVREGADPNAIRLIYGGNEGLS
LTEDGSLQVVTSFGNLTERSPYSYQIIEGNTIEVESSYQIFENGEVGYTIGEYDPAYPLI
IDPYLEYSTLLGGNLEDYGMDIARDSSGDVYVTGYTSSCNFPLRDPTVINTAYLKFNGSY
CHNSRDAFITKIGINQTTGNASIIFSTYLGGDKADFGRGIAVDSLKNIYVTGDTFSEDFP
IMLPFAYGDRLHGSNDAFVIKLDPTGTIIRWSDYLGGNFADQANDIALDSLNAVYLTGQT
VGNSPYKKLEQVFPTTPNAYQTAPNPDAVMGDAFAVKISPTGQVLEYSTYISGSGQDYGN
GIAVDGQGMAYITGTTSSTNLLPTGVPGYQKSIKGGQDAFLFKMNFQAGIPPIYATYLGG
STGYDYGEAVAVDSAGSAYVTGATASTDFPVTNMALQTVKGWPYDAFEKDAYVTKFGSDG
TGLIYSTYLGGSMDDWGYDIKVDSSFRAFVTGYSRSSQIPRSGLINTIKQASGGQDGFLT
VIKSDGRSAESSTLFGGYRDDVSRGVAISPDGNTSFVTGYTSSPTMLNLVCGSDCEREAF
PVYKWINQTVYGDRLYIGGNFSGDFQGSFDAFVMKFGQPSLVPSFSASPVCGTGEPNLTV
TFTETTTGSGNILNRIWNFGDGTPVNDTGAIPMVVSHNYTSPGTYQATLTLYTYTSILVS
DPVSITFCNPYTSANFTVAGYNNTADPIDVPINTDITFSGYAVNYTPTSYNWHFADGSAN
QTGQTTHHLFSQQGTYTVNMTAPSGTCCDNNTNIVGSKRIRVLAPPLARFVNSTTTPRIG
CLPLTVTFNDTSPVGTVDYGVPTAWQWNFGDNSWNGTTQNVTHTYQHAGTYTVSLTASNA
AGSNTYTQPGYVLVSGNVTAGFTASPRAGTAPLGVQFTDTSAGVPTSWDWRFGDGGSNTS
QNPYHVYNTAGTYTVNLTVTNDCGHVASANYTDWITVNGNMTPKILFGNSTFPPTSENPV
NGTPVLNVTFLGNTTDGTLIDSAVWSFGDSNTTTQTRAAGWPADNTWFNTSHKYYTVRDY
TPVLQITNTTYGSGTTGGLYTDWIGVYPPIIVNFSATPPSGIVGQSILFTDQSSGSPVNW
NWHFTDGSQNVSGLSSVSHVFNSTAVWNVMLEVWNKYGATGIGYRYVNITSADSSGQVYF
IPQNITLITEDLNYRVLNVVLSKADYGLSSYTIKIDLNNSARAHIRNWATSPSWVDHFTY
SVSPAFDSITLSGYKDSGMLPAGSRNISLGNISLTGISAGDADLRLNGTSIAQYGSSFMS
LTGVPADIHVYAVSPLPGYSNKPADIWPPGVHDGLIDDFDGNGVVNTADVTVFFNTWVSG
GFTGMPVPPFDYNHNNRIDTDDIVEYFNLIW
Download sequence
Identical sequences Q2FSN5
323259.Mhun_2497 gi|88603738|ref|YP_503916.1| WP_011449455.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]