SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88604274|ref|YP_504452.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88604274|ref|YP_504452.1|
Domain Number 1 Region: 473-524
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000034
Family Type I dockerin domain 0.0083
Further Details:      
 
Domain Number 2 Region: 142-428
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000051
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 
Domain Number 3 Region: 32-208
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000863
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88604274|ref|YP_504452.1|
Sequence length 528
Comment hypothetical protein Mhun_3046 [Methanospirillum hungatei JF-1]
Sequence
MLRHYSLILFGVLAILPVMVCGAAPGDILKNQVFGLPEGAEWGYGLDTSPDGNTTVCGVA
YPDQSINLEHLGNGDAWVLRFDTNGSIIWEKLFGGNETDYALSVRNLPDGGAAVIGTTGS
YNGDVTGYHGNGDLWFINLGPDGNIRWDRALGGSLTDEGSDVVLLPDRGYVLCGYTMSSD
GYTRRQLGGGDLWLIRLDRNGTVLWEQTYGGSRRDSGASITLTGDNSLVACGNTNSTDGM
VSGNRTSSDVWVIKTDLNGTVIWERSFGGSGLEWGHSVIELTSGDLMVAAVTASGDGDVG
KNHGAGDVWLMRITPDGTLVWKQTYGGSFSDNVWKLEPSPGGGAYLVGDSYSVDGHFTGN
HGESDLLIAEVDGDGNLLWYRQIGGSSVDRGSWVKHTNADTLMITGMTASSDGDISGDHS
SGDLWILEVEGSTAQPVSESEPLPAMTIPAEPAIGPLGGDGPVPTDPDGDGRYEDMNGNG
KTDLQDPTVFFKYFSWLQSQGYVSAFDFNENGALDLSDVQALFTEIQS
Download sequence
Identical sequences Q2FT69
gi|88604274|ref|YP_504452.1| 323259.Mhun_3046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]