SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88603394|ref|YP_503572.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603394|ref|YP_503572.1|
Domain Number 1 Region: 6-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 9.42e-121
Family Methyl-coenzyme M reductase gamma chain 0.0000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603394|ref|YP_503572.1|
Sequence length 252
Comment methyl-coenzyme M reductase subunit gamma [Methanospirillum hungatei JF-1]
Sequence
MAYTPQYGPGQSIVAENRRKQMNPNVKLEKIRNVTDEDIVLILGHRAPGQAYPTAHPPLA
EQGEPDCPIRKIVTPTDGAKAGDRVRYIQFADSMFNAPSQPYQRTYTECYRYRGIDPGTL
SGRQIVECRERDLEKISADLINTNLFDPARVGIRGATVHGHSLRLAEDGMMFDMLQRCIL
EGGTVKYVKDQIGTPLDKKVDVGKPMDDAWLKANTTMFHSLVGTPYRSDAEYIEYIQRIH
SLRTKYGFMPVE
Download sequence
Identical sequences Q2FSN1
323259.Mhun_2147 WP_011449111.1.85653 gi|88603394|ref|YP_503572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]