SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83590831|ref|YP_430840.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83590831|ref|YP_430840.1|
Domain Number 1 Region: 17-171
Classification Level Classification E-value
Superfamily YutG-like 4.71e-54
Family YutG-like 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83590831|ref|YP_430840.1|
Sequence length 177
Comment hypothetical protein Moth_2001 [Moorella thermoacetica ATCC 39073]
Sequence
MSVAQLKEKPQYSSSQLLKETAVAWLERRGVTLEDIARLVYDVQKKYIRELTLAACRESV
ERVLEKREVQNAVFTGIALDEMAEQGQLAEPLASMLKSDDGLYGIDEVMALSIVNIYGSI
GFTNFGYLDKVKPGIIGVVNDKKNEKVNTFLDDLVAAIAAAASSRLAHRDRDGRLNR
Download sequence
Identical sequences A0A1J5NUP4 Q2RGZ2
264732.Moth_2001 gi|83590831|ref|YP_430840.1| WP_011393497.1.24029 WP_011393497.1.52901 WP_011393497.1.64341 WP_011393497.1.90723 YP_430840.1.14147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]