SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91772230|ref|YP_564922.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91772230|ref|YP_564922.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.59e-32
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91772230|ref|YP_564922.1|
Sequence length 120
Comment hypothetical protein Mbur_0160 [Methanococcoides burtonii DSM 6242]
Sequence
MIEMIQGLPDKVVAVRLTGVVKGEDYDNILVPVIEDKVKEYGKIRVLYQLGPDYEKFSRK
AMLEDMELGVKNITSFDRIAVVSDVEWMNHAMELFKYMIPGQVKTYNNEELSEAKAWISE
Download sequence
Identical sequences Q12ZF4
259564.Mbur_0160 WP_011498336.1.71292 gi|91772230|ref|YP_564922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]