SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91772751|ref|YP_565443.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91772751|ref|YP_565443.1|
Domain Number 1 Region: 982-1070
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000549
Family Cadherin 0.052
Further Details:      
 
Domain Number 2 Region: 850-979
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000000471
Family Cellulose-binding domain family III 0.02
Further Details:      
 
Domain Number 3 Region: 1070-1123
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000147
Family Type I dockerin domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|91772751|ref|YP_565443.1|
Domain Number - Region: 672-731
Classification Level Classification E-value
Superfamily PKD domain 0.000334
Family PKD domain 0.0057
Further Details:      
 
Domain Number - Region: 155-413
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00173
Family Galacturonase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91772751|ref|YP_565443.1|
Sequence length 1126
Comment Ig [Methanococcoides burtonii DSM 6242]
Sequence
MKKVTKLFFLLGLLLATIDIGSASISYNSDYNQILVKDEVSINLTDIYDALYPTYGDQLI
SNAGNGIWYLNKTLLVDRSTVYITSPEVTELRVSGSTGVHLHGTSTGSDGKGYIIENVTI
VGWLKDFNMPDNTVSKKSINIDKGHVSNSVFKNVSTLKLYNVYDTDINNIEMESTSGSLE
IADGNNSTVHEIALYNTSGFYTYDLENFIFHNITVKDVHSIGTIRFTRTSHSLFYDFVIE
RIGSYLKPGSGGGLYWYDSSYNTGSDFYINDTGWSSFAPGNNYGNWSDLTILNSGHNGID
LHNIKNTIINNVHVYDSVSNNILLTAGLSDSPSTENITITNVYSKNSGIVSQQNVSDIYL
ANIYQEGDRDGMGISVQNFTLINATFASLNSDAQVSIYDSFGFENTNCNLIDTSFYHLNV
VADRRINLINSEYQTTYHKNHVTHYYSDLFVTYSNDIPAAGATIAVENTVDSSHSSLNGF
GNDKSMFLTTSNGHTELPNENRSESPAMPEYYKSSAGTQTFSHTATITTQDGQTLTLPNI
TPDSSWYRPDPNTPTYSITAIMPDESAGPHLTGFAPSESNPFNIGNTKKFQVWSDEDMTS
MKWIVDGETKQSTSLEYAWTVPDENGHTIIFEGTNANGIITKTWDINGGSGSVLPAITGA
FPGTSSRSQELGSSTDFSVTADQSMTSMVWYKNDAVIADGVMSTTVDWNEPGTYNIRFTA
SNDNGEVSRSWEVVSNEGAPILSDDLSVNNAPVITTFGPANNTVFQEGNVINIGVIASDA
DGDELTYLLKVDGATVSTTSGYVWTTDSSNIGAHTIGVVVSDGVEQVTDQHTIIVQNIVD
VGVTPVVMSSSAQIVSPGQPFSIGISIDPSEPVSGAQLDLLFDEQLVSAEGTIEGDLFNL
NGASTLFNSGTIGDSGVITDIYCSIIGAAPVSSKGTMATIAFTAGNTAGVAEFSLSDVVI
SNARSEGTPYTVTDTMVVIDTAPVLNSIGDKTVDEENALTFVTSASDADGDSLTYSATGL
PVGASFDTASGAFSWTPSEGQEGTYAIAFEVSDSYLTDSETISIAVKSHPRWDINRDCAV
NILDITLVSQKIGTDGAGTDQDVNQDGVVNIQDLTLVAQHFGETVE
Download sequence
Identical sequences Q12XY3
gi|91772751|ref|YP_565443.1| 259564.Mbur_0728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]