SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91773526|ref|YP_566218.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91773526|ref|YP_566218.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-20
Family GHMP Kinase, N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 218-297
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000465
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91773526|ref|YP_566218.1|
Sequence length 319
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Methanococcoides burtonii DSM 6242]
Sequence
MIKIRSPSRLHLSLIDLNAEIGRIDGGVGITLDHPNIVLSAEKADGVEVTGNCSFADRMV
EAAKAVLSVGEGVLIHVEEDMPAHVGLGSGTQSALSAAAAVNELYGLGLTVRELAIAVGR
GGTSGIGVASFESGGFLVDVGHKFSEKGSFSPSSASKAAPAPVVFRHDLPDWDIILAIPD
SVGAHDSQEVDIFKTECPIPLSEVQEVCHVVLMKMLPAILEGDIENFGFAVDHLQNVGFK
KREVALQSRQVRDLMEFMQDLGTCGAGMSSFGPAVFGFIDNRNMAEQIRDEVQHFLDETG
GGTVVLTKANNSGAMVWKD
Download sequence
Identical sequences Q12VQ8
WP_011499612.1.71292 259564.Mbur_1563 gi|91773526|ref|YP_566218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]