SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91774073|ref|YP_566765.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91774073|ref|YP_566765.1|
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily DNase I-like 2.88e-76
Family DNase I-like 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91774073|ref|YP_566765.1|
Sequence length 251
Comment exodeoxyribonuclease III [Methanococcoides burtonii DSM 6242]
Sequence
MNGLRSMLKKGFVEWMEATQPDILCLQETKATETQLPKELRHIHGYVPYFFSAERKGYSG
VGIYTKVPPVEVKYGLGVPRFDKEGRTLIVEFEDFALFNIYFPNGKASDERLEYKMDFYN
AFMEVADSMKDAGKNVIICGDVNTAHKEIDLARPKQNERSSGFLPQEREWIDTFLGHGYL
DTLRMFEPESGNYTWWDMKTRARDRNVGWRIDYFFASVSLKDRIRSAYILSDVMGSDHCP
IGIEVELGDSS
Download sequence
Identical sequences Q12U61
259564.Mbur_2145 gi|91774073|ref|YP_566765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]