SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91774330|ref|YP_567022.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91774330|ref|YP_567022.1|
Domain Number 1 Region: 186-432
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 5.76e-131
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000213
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 8.24e-76
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91774330|ref|YP_567022.1|
Sequence length 434
Comment methyl-coenzyme M reductase, beta subunit [Methanococcoides burtonii DSM 6242]
Sequence
MSDKVDIYDDRGTLLESDVDILNLAPTTNTAIGKIIKDTKRTVAINLAGIEKGLATGKYG
GKGRQILGRSLEYDIVGNADAIAESVANLVKVSNDDDTVVKVIGGGKQLLVQVPSARTDA
GADFVSGSTVSGAAVVETIINTFNTDMFDAPLVKGAVWGSYPQTMDMSGGNVASILSIPQ
QNEGLGFSLRNIMTNHVAAITGRKAMNAAALSSIYEQAGMYEMGNAVGSFERHQLLGFAY
QGLNANNVVYDIVKENGKTGTIGTVIDTVIEKAIDLGVIEVDHTAPSGYKFYKANDVSMW
NACAAAGQLAATLVNCGAGRAAQNVSSTIVYFNDILEKQTGLPGCDMGRAQGTGVGFSFF
SHSIYGGGGPGIFNGNHVVTRHSRGFAIPCVSAACAIDAGTQMITIEKTSALVGNVFGSI
EEFREPIKAVAGAL
Download sequence
Identical sequences Q12TF4
gi|91774330|ref|YP_567022.1| WP_011500407.1.71292 259564.Mbur_2421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]