SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384133876|ref|YP_005516590.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384133876|ref|YP_005516590.1|
Domain Number 1 Region: 62-218
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.61e-28
Family Nuclease 0.046
Further Details:      
 
Domain Number 2 Region: 278-353
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000314
Family Nuclease 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384133876|ref|YP_005516590.1|
Sequence length 433
Comment phospholipase D/Transphosphatidylase [Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1]
Sequence
MRVNKGRLRLRLTATLAPALLFLTACGPANVAPQNAVNSAPAHGKSTGAAPSKGVASIAA
SASQFTWIGEPGAGSAPWVKAISRARQRVDYNVYLLTDENIANALKQAAARGVAVRVILD
SHPYDFPDAVSKELAMFRGSKVQVKTWSPSATSYDHAKYLVVDGRVAIVGSANATYSALD
GGANLEDNVEIDGGILPADLDALFQADWSGRPRPSLPPALIVSPGSAEALANQIRQPGPV
MMAEEELYDAPDVMAAMEAKGRQLELLLPSSIDSEEMANARMLANHGVQVRLLSSPYVHA
KLIAGTEAVFVGSENLSANSLNDNREVGMVVTQPLVRAQAEAWFSHYWQKAQPLSSASGT
SDTWTSGSGKSASSGRTYPYLPLGISESEARAKWGPPSSISSTTYHGRPETVWTYPNGAR
LYFQDGKLVHVSR
Download sequence
Identical sequences F8IIB2
WP_014462989.1.27192 gi|384133876|ref|YP_005516590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]