SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433633419|ref|YP_007267046.1| from Mycobacterium canettii CIPT 140070017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433633419|ref|YP_007267046.1|
Domain Number 1 Region: 131-402
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.34e-45
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 
Domain Number 2 Region: 510-685
Classification Level Classification E-value
Superfamily TPR-like 0.0000103
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|433633419|ref|YP_007267046.1|
Sequence length 750
Comment Putative serine/threonine-protein kinase PknG [Mycobacterium canettii CIPT 140070017]
Sequence
MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNADEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPASRHFTTARLTSAVTLLSGRSTSEVTEEQ
IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Download sequence
Identical sequences gi|433633419|ref|YP_007267046.1| WP_015292139.1.53973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]