SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392380738|ref|YP_005029934.1| from Azospirillum brasilense Sp245

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392380738|ref|YP_005029934.1|
Domain Number 1 Region: 25-89
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000445
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392380738|ref|YP_005029934.1|
Sequence length 269
Comment conserved protein of unknown function [Azospirillum brasilense Sp245]
Sequence
MGVAIPNASTMNWFQFRGITNELDSNLASTDYRQFTVSKAGEFNFRIADINTNIKIVDQN
NKVVAEAKAKNEAAEASAKLGPGTYTAVISQAVRGVNEREYTLDITERQNIMMVGTGAQM
KGTARAVLGKDPGVQKHTLTVAQGGEFVGNMSLPLTRWALMSKEGKVVASGDTMDPAKSG
EDMLKKPSFKIDPGQYELVIVPPKNVVGEIPYQLNFVQKVAKTPESTEERPFDKIMRERE
ARLKQWAAEDANKSSSTSKTTPYKMSLLA
Download sequence
Identical sequences G8AFA1
WP_014238772.1.1190 gi|392380738|ref|YP_005029934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]