SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478479021|ref|YP_007709672.1| from Pseudomonas aeruginosa B136-33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478479021|ref|YP_007709672.1|
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 1.57e-60
Family PA2201 N-terminal domain-like 0.000000269
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 4.71e-44
Family PA2201 C-terminal domain-like 0.0000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478479021|ref|YP_007709672.1|
Sequence length 294
Comment hypothetical protein G655_14145 [Pseudomonas aeruginosa B136-33]
Sequence
MHAFPLTLDNRLADALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDNLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences WP_015502953.1.36148 gi|478479021|ref|YP_007709672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]