SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mixos1|70252|estExt_Genewise1Plus.C_1_t50155 from Mixia osmundae IAM 14324 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mixos1|70252|estExt_Genewise1Plus.C_1_t50155
Domain Number 1 Region: 14-121
Classification Level Classification E-value
Superfamily PH domain-like 5.97e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 161-271
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.8e-16
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mixos1|70252|estExt_Genewise1Plus.C_1_t50155
Sequence length 494
Sequence
MTISSAEKALIKKHAVLSSSDKITSGAIARIYYASPDARQWSFSGLTGAIVLGKNDKTCW
FRMVDLQGSQGLTWTHEIYNDFSYHQDRTFFHSFEGDSCMVGFVFADEGEASDFYRKVIA
KSHFRPKKSKAVATPQSSPTTSKSTKKRKGAIDKSMIGAPSSFKHVAHMGFDSDKGFTSE
NVDPSWKTLLTQMESMGVSKADIKKNEKFIRDYVAKAGGPEQAAAANRASTSLPAPPPPP
TSTSSVARATTSKRKQPPPPPASRKAAIPEPDVQAPPPPPLPPSRASVAIPPPPPPAPPG
RTSVAAPPPPPASAARNSVIAPPPPPPPPPGRQVASVPPPPPPNRSSAAVPPAPPPPAPS
TRSGAAPPPPPPPPSSSAIPPPPPPPPTRAGPASVAPPPPPPPPAPSGGAAAAILPPEAA
ALPGRSDLLASIQGKSVANLRKTDTSTADAREAAPAATEAAPADLAATLALALHQRKGNM
GDSDEEADSDDEEW
Download sequence
Identical sequences G7DTH9
jgi|Mixos1|70252|estExt_Genewise1Plus.C_1_t50155 XP_014571408.1.41237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]