SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089054|ref|NP_615129.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089054|ref|NP_615129.1|
Domain Number 1 Region: 36-236
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.28e-20
Family Terpene synthases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20089054|ref|NP_615129.1|
Sequence length 238
Comment hypothetical protein MA0156 [Methanosarcina acetivorans C2A]
Sequence
MLNNLEFDIVKKGFEWLSSRQIQSVKELASTVSAHALWGLPNLYTPLLIRKKEGNCWNSS
IRDTARACSALSAEGIIFRAPEKWLLSMKTGSSWNEDVYDTAYSLGALADMEVSDREGCG
WLYENYGPDWEQVGTTSLVITALKKQDNLTESRDFEAFVRERAEWILSKRKQDGGWEHIS
TSNLVIQALLLAGFKKELGASIDWLLGKARESGAWGNKEDDINATALTLSTLGMYEKA
Download sequence
Identical sequences Q8TUB7
WP_011020214.1.98848 188937.MA0156 gi|20089054|ref|NP_615129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]