SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089305|ref|NP_615380.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089305|ref|NP_615380.1|
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000165
Family Galacturonase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20089305|ref|NP_615380.1|
Sequence length 226
Comment hypothetical protein MA0412, partial [Methanosarcina acetivorans C2A]
Sequence
MTIKESHMEGIKAVRECEDVTIENCNIQSSEFGWLSHRMIIKNTELESEYPFFYSSDILL
DNFILNGKYSFQYVKNVEIRDSCLDTKDAFWHSKNVTVSNSIVKGEYLGWYSENLKLIRC
KIIGTQPLCYAKGLILEDCEMIGCDLAFEYSEVHAVITGSITSVKNPCSGHISADSIGEV
ILDENQPVDVSCVIEGRSELNKEEIQNSDNCNGNLFNNKDFPVQET
Download sequence
Identical sequences Q8TTL8
gi|20089305|ref|NP_615380.1| 188937.MA0412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]