SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089386|ref|NP_615461.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089386|ref|NP_615461.1|
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.62e-19
Family Galacturonase 0.076
Further Details:      
 
Domain Number 2 Region: 369-449
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000102
Family Carboxypeptidase regulatory domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|20089386|ref|NP_615461.1|
Domain Number - Region: 453-526
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0145
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20089386|ref|NP_615461.1|
Sequence length 688
Comment hypothetical protein MA0497 [Methanosarcina acetivorans C2A]
Sequence
MKSGVTLNGNGIGATVIYCDNPSSNFATQNIIHCEGVSDIEISNFLIDGGWESLSIMHAA
SNRYREYEKGVYLRGCSNVAVHDLKMQYSMGDFIYCSRNTNNVQVYNTVCKPGHDSFDAW
SAGDGISIYNNCWGTFINSCIKIHNTKNVQIYKNTFYTDTGSGNAGVEVMGGDVTGLNIH
NNIFSTLRLNTIYQDLADGTSSGSGTVSNNIFYNSPSYNGIGGLDIVSTGNIVTSSYSCS
RGTEDYGYVADNGTRNLPDYNGSVIPSVTFPADDSTISTVNGYVSISWSYLNATSYSINV
YNSASQFDSSHLIYSLNTSQTSANVPISSTGTYAIKIGAHDDVHNSWVYNSPVSFFTVNG
KKSATVYSGVYGYLTDAATGQPVQSAVITLSNDQEDCTQITDVDGLYQFTVNNEEGTYCL
TASATGYHNSPELPVNMTGINTEINLKMVKTPDYSEPHYVQLYVCTDSNKSVPGCEIRIY
APNNDLANEKPNFCAWTNNDGRATFHLIRDVTYKIVTITLDGQKYTSTLTPNLGQHIITI
PSGDTAAIPPMQTVISTNCTYKPINNTAAYINASYYDSSSQSSDLIFVLGTMSEGKTFVP
LGISGTNDNVSNPVGVITDSFIVTDCSGKTYTVKISAQSQTYGAVYETVNVTVPGSNVPD
VGSTYMSYFCVLILIIAGLVLSKTRKAH
Download sequence
Identical sequences Q8TTE0
gi|20089386|ref|NP_615461.1| 188937.MA0497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]