SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089477|ref|NP_615552.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089477|ref|NP_615552.1|
Domain Number 1 Region: 29-256
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.51e-45
Family Pectin methylesterase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20089477|ref|NP_615552.1|
Sequence length 370
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MERIKERHLQALKIVSVAFILAVICTTCTAISAANLNVNPEAEGGYATIQAAVDAANDGD
TIFVSQGTYNENLKINKQVRIWSDSRNPENTIVKAADPAESAVEITADRATFSGFGVEDS
NKAGILLTGVNNCYINNNLAKNSEYGILLQNAGTNNINGNTMTLNEVGIRLEGSDSNTIQ
DNLIAYNYEYGISLKESSKNIIYNNYFKNAENVEENTVNSDNNWHSTLSTKSNLIRGPYI
GGNFWADLEGTGYSETCVDENSNGICDASYEVSGGGTDNSPLYPKVPAAVTALENELDAE
AYEQGLEDREGAANVTETPLEAVTEEVNETAGEGEETPETEAEEENGAPGPSLGLAVLAT
GAAYILKRKR
Download sequence
Identical sequences Q8TT51
188937.MA0588 gi|20089477|ref|NP_615552.1| WP_011020637.1.98848 MvR158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]